PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00034307-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 295aa    MW: 33001.9 Da    PI: 5.2335
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00034307-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-152467146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      rg++T+eE+  +++++  lG++ W++Ia+ ++ gRt++++k++w +
  PSME_00034307-RA 24 RGSFTEEEERTIIQLHGILGNR-WSAIASQLP-GRTDNEIKNFWST 67
                      89********************.*********.***********65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.391118IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.4E-11531IPR009057Homeodomain-like
SuperFamilySSF466894.06E-21577IPR009057Homeodomain-like
PROSITE profilePS5129425.1511973IPR017930Myb domain
SMARTSM007172.1E-152371IPR001005SANT/Myb domain
PfamPF002493.1E-142467IPR001005SANT/Myb domain
CDDcd001676.37E-112665No hitNo description
Gene3DG3DSA:1.10.10.604.1E-213270IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGLLRCGKSC RLRWTNYLRP DIKRGSFTEE EERTIIQLHG ILGNRWSAIA SQLPGRTDNE  60
IKNFWSTRLK KRLLKMGLDP ATHAPRGEVN PTAGPEGLEA LALTRHKAQW ENARLEAEAR  120
LSRESLLMSS SNTITTPASN NPAPCTDYFL KLWNSEAGKA FRNEETHHPN RGGDNSEIPV  180
MCCASTGQNS CDQLLNPNDK DKHNGSQLEC GDCNVKIGGV LSCFGDMATG KMEDKTTEEL  240
DFPELLLDFP DNDDMNSNIQ SELITAFQQK PASPWPQLHD QDFWSNLSFI DHDSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-2257340108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497557.14e-74PREDICTED: transcription repressor MYB6-like
TrEMBLV7B5Y44e-72V7B5Y4_PHAVU; Uncharacterized protein
STRINGGLYMA09G39721.12e-69(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.12e-59myb domain protein 17